Follistatin 344 1mg

Follistatin 344 1mg

SOLAR ECLIPSE SALE 30% OFF EVERYTHING Simply use discount code: SOLAR

Follistatin 344 1mg

was $187.99 Special Price $134.99
Out of stock
SKU
30039
  • Buy 2 for $128.24 each and save 6%
  • Buy 5 for $121.49 each and save 11%
  • Buy 10 for $114.74 each and save 16%
More Information
CAS Number 80449-31-6
PubChem 16132341
Residue Sequence GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW
Molar Mass 37.80 kDa
Physical Appearance Fine White Lyophilized Powder
Solubility 100 μg/mL sterile diluent (distilled de-ionized water)
Stability Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C.
Source Biosynthetic production
This product is prepared for LABORATORY RESEARCH USE ONLY and may not be used for other purposes.