IGF-1 DES 1,3 1mg

IGF-1 DES 1,3 1mg

SOLAR ECLIPSE SALE 30% OFF EVERYTHING Simply use discount code: SOLAR

IGF-1 DES 1,3 1mg

was $99.99 Special Price $69.99
In stock
SKU
30022
  • Buy 2 for $66.49 each and save 6%
  • Buy 5 for $62.99 each and save 11%
  • Buy 10 for $59.49 each and save 16%
More Information
CAS Number 77591-33-4
Molecular Formula C319H501N91O96S7
Residue Sequence TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass 7371.4 g/mol
Physical Appearance Fine White Lyophilized Powder
Solubility 100 μg/mL sterile diluent (distilled de-ionized water)
Stability Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C.
Source Biosynthetic production
This product is prepared for LABORATORY RESEARCH USE ONLY and may not be used for other purposes.