ACVR2B (ACE-031) 1mg

-28%

ACVR2B (ACE-031) 1mg

$187.99 $134.99

Out of stock

  • Additional information
  • Usage

Additional information

Weight 0.0099 lbs
Physical Appearance

Fine White Lyophilized Powder

Residue Sequence

MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Solubility

100 μg/mL sterile diluent (distilled de-ionized water)

Source

Biosynthesis

Stability

Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C.

Molar Mass

40.5 kDa

Options container

container2

This product is prepared for LABORATORY RESEARCH USE ONLY and may not be used for other purposes.