IGF-1 DES 1,3 1mg

-30%

IGF-1 DES 1,3 1mg

$99.99 $69.99

In stock

Bulk Pricing
From To Discount
1 2 N/A
3 4 3%
5 9 5%
10 * 8%
Purchase this product now and earn 70 Points!

  • Description
  • Additional information
  • Usage

Description

Additional information

Weight 0.0099 lbs
Physical Appearance

Fine White Lyophilized Powder

Residue Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Solubility

100 μg/mL sterile diluent (distilled de-ionized water)

Source

Biosynthetic production

Stability

Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C.

Molar Mass

7371.4 g/mol

CAS Number

77591-33-4

Molecular Formula

C<sub>319</sub>H<sub>501</sub>N<sub>91</sub>O<sub>96</sub>S<sub>7</sub>

MG

2 MG

Options container

container2

This product is prepared for LABORATORY RESEARCH USE ONLY and may not be used for other purposes.