IGF-1 DES 1,3 1mg

Buy 2 Get 1 Free
Cannot be combined with other offers or discounts

-30%

IGF-1 DES 1,3 1mg

$99.99 $69.99

Availability: In stock
Purchase this product now and earn 70 Points!
  • Additional information
  • Usage

Additional information

Weight 0.0099 lbs
Physical Appearance

Fine White Lyophilized Powder

Residue Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Solubility

100 μg/mL sterile diluent (distilled de-ionized water)

Source

Biosynthetic production

Stability

Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C.

Molar Mass

7371.4 g/mol

CAS Number

112603-35-7

Molecular Formula

C319H501N91O96S7

MG

2 MG

Options container

container2

This product is prepared for LABORATORY RESEARCH USE ONLY and may not be used for other purposes.